A0A067QHV7 | AlphaLasso

Domain	Eukaryota
Family	Termopsidae
Species (Full Name)	Zootermopsis nevadensis (Dampwood termite)
Gene	L798_01960
PFAM codes	PF00095
InterPro codes	IPR008197, IPR036645
PDB structures (whole Protein)	-

Identical Structures in AlphaLasso - computed using the Web Server in job: 25e4cebac0a714

Structure ID	Identity	Method	Length	AF Model Topology
A0A067QHV7-F1	100.0%	MMseqs2	50	2L1
A0A6L2PV86-F1	77.6%	MMseqs2	73	2L1
A0A7M7H308-F1	70.0%	MMseqs2	73	2L1

Categories voted by users:

Structure view

Help

Computed using the Web Server in job: 25e4cebac0a714

Help Lasso data interpretation

Protein name	WAP domain-containing protein
Global pLDDT	83.75
Species	Dampwood termite
UniProt	A0A067QHV7
Structure Prediction Model	AlphaFold v4: A0A067QHV7
PDB structures	-
Model length	50
AlphaFold deposition date	2022-09-30
AlphaLasso deposition date	2024-04-14

Lasso types & Model sequence

			Bridge type			DeepShallow Lasso pLDDT	Global pLDDT	N-end GLN	C-end GLN	Loop range	Loop Length	N-term crossings	C-term crossings	N-end length	C-end length	Loop area
						86.1286.12	83.75	0.059	-0.904	5-31	27		-38 -38	4	19	282
						86.6486.64	83.75	0.343	-0.837	14-35	22		-38 -38	13	15	211

KSGHCPPSRRVTNCFNRCKTDYVCSFDEKCCPNVCGSESCAKSSSISYGS

Lasso diagram

Loading diagram...

Comments

A0A067QHV7 F1