A0A7K5IYK4 F1

Carbonic anhydrase (EC 4.2.1.1)
Domain Eukaryota
Species (Full Name) Toxostoma redivivum (California thrasher)
Gene Ca13 TOXRED_R01930
PFAM codes  PF00194
InterPro codes  IPR001148,  IPR018338,  IPR023561,  IPR036398
PDB structures (whole Protein) -
L0
Categories voted by users:
Structure view
Help
Protein name
Carbonic anhydrase (EC 4.2.1.1)
Global pLDDT
97.62
Species
California thrasher
UniProt
Structure Prediction Model
AlphaFold v4:  A0A7K5IYK4
PDB structures
-
AlphaKnot
Model length
248
AlphaFold deposition date
2022-09-30
AlphaLasso deposition date
2024-11-06
Lasso types & Model sequence
Bridge type DeepShallow Lasso pLDDT Global pLDDT N-end GLN C-end GLN Loop range Loop Length N-term crossings C-term crossings N-end length C-end length Loop area
NoneNone 97.62 0.553 0.126 142-208 67
141 40 1118
Model Sequence
GPAHWKEVFPVANGDRQSPIDIKTEETKYDPSLRPLNPSYDPASAKIILNNGHSTSVEFDDTVNKSVLTGGPLSGTYRLRQIHFHWGSNDEAGSEHTVDGMKYAAELHVVHWNAEKYSSFVEAASQSDGLAVMAVFLKIGECNPQLNKITDRLDTIRIKGKKALFTNFDPSCLLPKSLDYWTYFGSLTVPPLLESVIWIVLREPISVCSEQLAKFRSLLSTAEDEVACCLLRNFRPPQPLRGREVRRN
Lasso diagram
Loading diagram...
Comments

The AlphaLasso website is licensed under CC BY 4.0