| Domain |
Eukaryota
|
| Family |
Hominidae
|
| Species (Full Name) |
Homo sapiens
|
| Gene |
CA12
|
| PFAM codes |
PF00194
|
| InterPro codes |
 IPR001148, IPR018338, IPR023561, IPR036398
|
| PDB structures (whole Protein) |
 1JCZ A/B: 30-291 1JD0 A/B: 30-291 4HT2 A/B/C/D: 30-291 4KP5 A/B/C/D: 30-291 4KP8 A/B/C/D: 30-291 4Q0L A/B/C/D: 30-291 4QJ0 A/B/C/D: 30-291 4QJO A/B/C/D: 30-291 4QJW A/B/C/D: 30-291 4WW8 A/B/C/D: 30-291 5LL5 A/B/C/D: 30-291 5LL9 A/B/C/D: 30-291 5LLO A/B/C/D: 30-291 5LLP A/B/C/D: 30-291 5MSA A/B/C/D: 30-291 5MSB A/B/C/D: 30-291 6G5L A/B/C/D: 30-291 6G7A A/B/C/D: 30-291 6QN0 A/B/C/D: 30-291 6QNG A/B/C/D: 30-291 6QNL A/B/C/D: 30-291 6R6Y A/B/C/D: 30-291 6R71 A/B: 30-291 6RPS A/B: 31-291 6T5P A/B/C/D: 30-291 6T5Q A/B/C/D: 30-291 7PP9 A/B/C/D: 30-291 7PUU A/B/C/D: 30-291 7PUV A/B/C/D: 30-291 7PUW A/B/C/D: 30-291
|
#similar chains with experimentally solved models (PDB) in the AlphaLasso database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains with experimentally solved models not found in AlphaLasso database but found in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
| Protein name |
Carbonic anhydrase 12 (EC 4.2.1.1) (Carbonate dehydratase XII) (Carbonic anhydrase XII) (CA-XII) (Tumor antigen HOM-RCC-3.1.3)
|
| Global pLDDT |
87.65
|
| Species |
Human
|
| UniProt | |
| Structure Prediction Model |
AlphaFold v4:
 O43570
|
| PDB structures |
1JCZ A/B 1JD0 A/B 4HT2 A/B/C/D 4KP5 A/B/C/D 4KP8 A/B/C/D 4Q0L A/B/C/D 4QJ0 A/B/C/D 4QJO A/B/C/D 4QJW A/B/C/D 4WW8 A/B/C/D 5LL5 A/B/C/D 5LL9 A/B/C/D 5LLO A/B/C/D 5LLP A/B/C/D 5MSA A/B/C/D 5MSB A/B/C/D 6G5L A/B/C/D 6G7A A/B/C/D 6QN0 A/B/C/D 6QNG A/B/C/D 6QNL A/B/C/D 6R6Y A/B/C/D 6R71 A/B 6RPS A/B 6T5P A/B/C/D 6T5Q A/B/C/D 7PP9 A/B/C/D 7PUU A/B/C/D 7PUV A/B/C/D 7PUW A/B/C/D
|
| AlphaKnot |
 O43570 31
|
| Model length |
354
|
| AlphaFold deposition date |
2022-09-30
|
| AlphaLasso deposition date |
2024-04-15
|
| show shallow lasso | Bridge type | Deep Lasso pLDDT | Global pLDDT | N-end GLN | C-end GLN | Loop range | Loop Length | N-term crossings | C-term crossings | N-end length | C-end length | Loop area | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 |
98.14 | 87.65 | 0.197 | 2.023 | 50-230 | 181 | +244, +286 |
49 | 124 | 2845 | ||||||
Model Sequence |
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
|
The AlphaLasso website is licensed under CC BY 4.0
O43570