P07851 F1

Chymotrypsin/elastase isoinhibitor 1 (AsC/E-1) (C/E-1 inhibitor)
Domain Eukaryota
Family Ascarididae
Species (Full Name) Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
PFAM codes  PF01826
InterPro codes  IPR002919,  IPR036084
PDB structures (whole Protein)  1EAI C/D: 1-61
...loading similar chains, please wait...
similar chains with experimentally solved models (PDB) in the AlphaLasso database (?% sequence similarity)
...loading similar chains, please wait...
similar chains with experimentally solved models not found in AlphaLasso database but found in thePDB database (?% sequence similarity)

  
#similar chains with experimentally solved models (PDB) in the AlphaLasso database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
        #similar chains with experimentally solved models not found in AlphaLasso database but found in the pdb database (?% sequence similarity)
        ...loading similar chains, please wait...
L1
Categories voted by users:
Structure view
Help
Protein name
Chymotrypsin/elastase isoinhibitor 1 (AsC/E-1) (C/E-1 inhibitor)
Global pLDDT
88.38
Species
Pig roundworm
UniProt
Structure Prediction Model
AlphaFold v4:  P07851
PDB structures
Model length
63
AlphaFold deposition date
2022-09-30
AlphaLasso deposition date
2024-04-14
Lasso types & Model sequence
Bridge type DeepShallow Lasso pLDDT Global pLDDT N-end GLN C-end GLN Loop range Loop Length N-term crossings C-term crossings N-end length C-end length Loop area
90.2290.22 88.38 -0.769 0.021 21-60 40
-16 -16
20 3 507
NoneNone 88.38 -0.094 -0.417 5-38 34
4 25 440
Model Sequence
GQESCGPNEVWTECTGCEMKCGPDENTPCPLMCRRPSCECSPGRGMRRTNDGKCIPASQCPEH
Lasso diagram
Loading diagram...
Comments
How to cite

The AlphaLasso website is licensed under CC BY 4.0