P22748 | AlphaLasso

Domain	Eukaryota
Family	Hominidae
Species (Full Name)	Homo sapiens
Gene	CA4
PFAM codes	PF00194
InterPro codes	IPR001148, IPR018338, IPR023561, IPR036398, IPR041874
PDB structures (whole Protein)	1ZNC A/B: 19-284 3F7B A/B: 19-284 3F7U A/B/C/D: 19-284 3FW3 A/B: 19-284 5IPZ A/B/C/D: 19-284 5JN8 A/B/C/D: 19-284 5JN9 A/B/C/D: 19-284 5JNA A/B/C/D: 19-284 5JNC A/B/C/D: 19-284 5KU6 A/B/C/D: 19-284

...loading similar chains, please wait...
similar chains with experimentally solved models (PDB) in the AlphaLasso database (?% sequence similarity)

...loading similar chains, please wait...
similar chains with experimentally solved models not found in AlphaLasso database but found in thePDB database (?% sequence similarity)

#similar chains with experimentally solved models (PDB) in the AlphaLasso database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
        #similar chains with experimentally solved models not found in AlphaLasso database but found in the pdb database (?% sequence similarity)
        ...loading similar chains, please wait...

LS2

Categories voted by users:

Structure view

Help

Protein name	Carbonic anhydrase 4 (EC 4.2.1.1) (Carbonate dehydratase IV) (Carbonic anhydrase IV) (CA-IV)
Global pLDDT	89.01
Species	Human
UniProt	P22748
Structure Prediction Model	AlphaFold v4: P22748
PDB structures	1ZNC A/B 3F7B A/B 3F7U A/B/C/D 3FW3 A/B 5IPZ A/B/C/D 5JN8 A/B/C/D 5JN9 A/B/C/D 5JNA A/B/C/D 5JNC A/B/C/D 5KU6 A/B/C/D
AlphaKnot	P22748 3₁
Model length	312
AlphaFold deposition date	2022-09-30
AlphaLasso deposition date	2024-04-14

Lasso types & Model sequence

show shallow lasso			Bridge type			DeepShallow Lasso pLDDT	Global pLDDT	N-end GLN	C-end GLN	Loop range	Loop Length	N-term crossings	C-term crossings	N-end length	C-end length	Loop area
						97.1297.12	89.01	0.159	1.992	46-229	184		+243, +282 (+236), (-236), +243, +282	45	83	3083
						NoneNone	89.01	0.039	0.212	24-36	13			23	276	109

Model Sequence

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR

Lasso diagram

Loading diagram...

Comments

P22748 F1

LS2

Model Sequence