Status Status Details Model fingerprint Project name Input data Model lengths Last status changed Job submitted Key Job parameters
FINISHED 2025-12-25 10:32:02.671598+01:00: AF-A0A7X8LV60-F1 - main chain lassoed: ['L-3N'] L-3N Recomputed from: A0A7X8LV60-F1-AFv4 AF-A0A7X8LV60-F1.cif
 329 12/25/2025 10:32:02 12/25/2025 10:24:10 818b8a246093cf
Smoothing iterations: 20
What to compute: Full matrix always
Search identical: Identity 70%
Identity in all AL and AF models: False
Disulfide bridge length: 0.0 to 3.0
Amide bridge length: 0.0 to 2.5
Ester bridge length: 0.0 to 1.6
Thioester bridge length: 0.0 to 2.3

Results for job AF-A0A7X8LV60-F1

Topology type: COMPLEX

Structure view
Help

Lasso data interpretation
Information
Loop fingerprint L-3N
Global pLDDT 97.7

Artifact check
Model
C-alpha clashes No clashes
pLDDT model Very high (97.7); 99.7% has >70 pLDDT; 0.0% has <50 pLDDT
L-3N
pLDDT loop Very high (98.2); 100.0% has >70 pLDDT; 0.0% has <50 pLDDT
pLDDT N-end tail Very high (97.8); 100.0% has >70 pLDDT; 0.0% has <50 pLDDT
pLDDT C-end tail Very high (90.8); 91.7% has >70 pLDDT; 0.0% has <50 pLDDT
Lasso types & Model sequence
show shallow lasso Bridge type DeepShallow Lasso pLDDT Global pLDDT N-end GLN C-end GLN Loop range Loop length N-term crossings C-term crossings N-end length C-end length Loop area Detection method
98.098.0 97.7 -0.898 0.209 199-318 120
-125, +152, -179 -125, +152, -179, (+180), (-180)
198 11 2059
Model Sequence
MRKYKFAILGAGSIAEKMAETVIHMPQIIPYAVGSRDSDRAKSFSERFGFQKYYGSYGEMVQDSEIDLIYVATPHSHHYKHSMMCLRHGKHVLCEKAFTVNALQAEKLTDYARSKNLLIAEAIWTRYLPMSKTINEIIESGAIGKVNLISANLGYLISNKERLVNPYLAGGALLDVGVYTLNFAAMILGDRIIKSASTCSLFETGVDSQGSMTLLFEGGEMAVLYFSAVAQTDRQGIVYGDKGTLVVENINNPETVHVYNLNREKVASYPAPKQITGFEYEVDSVIKAIEQGRLECPEMPHSEIIRIMRLMDDFRNQCGVIYPPDIEGC
Lasso diagram   
Loading diagram...
Identical Structures in AlphaLasso
Structure ID Identity Method Length AF Model Topology Link
A0A7X8LV60-F1
96.8%
MMseqs2
329
L3
How to cite

The AlphaLasso website is licensed under CC BY 4.0